Anti-ALDH1A1 antibody produced in rabbit

تاریخ انتشار: 09-01-2020

Anti-ALDH1A1 antibody produced in rabbit

نام شرکت:
نام فارسی:
Catalog Number:
Cas Number:

100UL

Synonym: Anti-ALDH-E1, Anti-ALHDII, Anti-Aldehyde dehydrogenase family 1 member A1, Anti-Aldehyde dehydrogenase, cytosolic, Anti-RALDH 1, Anti-RalDH1, Anti-Retinal dehydrogenase 1

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Eigenschaften
Related Categories AF-AP, AL-AL, ALDH1A, Alphabetical Index, Antibodies,
Breast Cancer Stem Cell Markers, Cancer Research, Cancer Stem Cells, Cell Biology, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary Antibodies
Less…
product line Prestige Antibodies® Powered by Atlas Antibodies
conjugate unconjugated
clone polyclonal
biological source rabbit
application(s) immunoblotting: 0.4 μg/mL
immunofluorescence: 1-4 μg/mL
immunohistochemistry: 1:500- 1:1000
species reactivity human
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation
form buffered aqueous glycerol solution
shipped in wet ice
storage temp. −20°C
antibody form affinity isolated antibody
antibody product type primary antibodies
immunogen sequence IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
Featured Industry Research Pathology
UniProt accession no. P00352
Gene Information human … ALDH1A1(216)

Beschreibung
Immunogen

Retinal dehydrogenase 1 recombinant protein epitope signature tag (PrEST)
Application

Anti-ALDH1A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Biochem/physiol Actions

Aldehyde dehydrogenase 1 family member A1 (ALDH1A1) belongs to the aldehyde dehydrogenase family.[2] It plays a crucial role in ethanol metabolism in human.[3] In addition to ethanol detoxification, it also has high impact on the metabolism of neurotransmitters and retinoic acid synthesis.[5] It catalyzes the oxidation of endogenous and exogenous aldehydes depending on NAD(P)(+).[4]
Linkage
Corresponding Antigen APREST86228.

جهت استعلام قیمت این محصول، به درخواست قیمت آنلاین مراجعه نمایید.

به اشتراک بگذارید: